DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaSnap2 and Y59A8B.25

DIOPT Version :9

Sequence 1:NP_649980.1 Gene:gammaSnap2 / 41239 FlyBaseID:FBgn0266721 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001041199.1 Gene:Y59A8B.25 / 4363109 WormBaseID:WBGene00044794 Length:145 Species:Caenorhabditis elegans


Alignment Length:130 Identity:37/130 - (28%)
Similarity:67/130 - (51%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ASEFASKVSRILVRLKKYEEATKALKKEISLNLQTKSYGQVGRLVVALILVQLTLEDYVDAKKTF 211
            ||.|..:::::.::|..|:.|..::::||....:.:.|.::|:|.:.|::|.|.|||.|.|.|.:
 Worm     2 ASNFLKQITKLSLQLTDYKGALGSIREEIEKFAEIREYPRIGQLGIGLVIVNLALEDSVAALKDY 66

  Fly   212 KKWGNRCDPQEVNT------LQNLLKAFDDEDPELATKMLASPFIRHMDVEYALLSKDVPLPKGN 270
             .| ..|...:..|      .:||:..::..|.|....:|....:|.||.||..:.|.:..|.||
 Worm    67 -GW-VICQSPDFQTSEDGRVCENLIGFYEAGDDESFQNVLKCGALRSMDNEYLRVMKILKAPSGN 129

  Fly   271  270
             Worm   130  129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaSnap2NP_649980.1 SNAP 29..239 CDD:305195 26/97 (27%)
TPR repeat 29..61 CDD:276937
TPR repeat 65..102 CDD:276937
TPR repeat 105..140 CDD:276937
TPR repeat 144..180 CDD:276937 8/32 (25%)
Y59A8B.25NP_001041199.1 SNAP <50..122 CDD:305195 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1585
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2838
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1540214at2759
OrthoFinder 1 1.000 - - FOG0003744
OrthoInspector 1 1.000 - - mtm4851
orthoMCL 1 0.900 - - OOG6_103437
Panther 1 1.100 - - O PTHR13768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.