DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaSnap2 and alphaSnap

DIOPT Version :9

Sequence 1:NP_649980.1 Gene:gammaSnap2 / 41239 FlyBaseID:FBgn0266721 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_524180.1 Gene:alphaSnap / 40233 FlyBaseID:FBgn0250791 Length:292 Species:Drosophila melanogaster


Alignment Length:279 Identity:59/279 - (21%)
Similarity:108/279 - (38%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKIEEAEALIGQTDSAANEYAKA-GMYFKAATAYRIAKSFDKRKDCLLKAIDCYENNKSWFHAAK 70
            ||:.:.:..:|.....:|:...| ..|.:|...::::|::.|..:|..:|...:....|...|..
  Fly    17 KKLTQQKGFLGSLFGGSNKVEDAIECYQRAGNMFKMSKNWTKAGECFCEAATLHARAGSRHDAGT 81

  Fly    71 SYEQIILLAKETDKLSEVEDYAN---RACCLYQQHGSPEAAAAALDKAAKMTESKHPDLA--LGF 130
            .|..    |....|..:||...|   ::..:|...|....||......|:|.||...:||  :..
  Fly    82 CYVD----ASNCYKKVDVESAVNCLMKSIDIYTDMGRFTMAAKHHQSIAEMYESDPNNLAKSIQH 142

  Fly   131 YKRALAVVLIGDSTHQASEFASKVSRILVRLKKYEEATKALKKEISLNLQT-------KSY---G 185
            |::|.......:|...|::...||::...:|:.||:|....::..:.:|::       |.|   .
  Fly   143 YEQAADYFKGEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESSLLKYSAKEYFFRA 207

  Fly   186 QVGRLVVALILVQLTLEDYV-------DAK--KTFKKWGNRCDPQEVNTLQNLLKAFD------- 234
            .:..|.|.|:..|..:|.|.       |::  |..|......:.|.:......:|.:|       
  Fly   208 ALCHLSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLEEQNIEGFTEAVKDYDSISRLDQ 272

  Fly   235 -------------DEDPEL 240
                         ||||:|
  Fly   273 WYTTILLRIKKAADEDPDL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaSnap2NP_649980.1 SNAP 29..239 CDD:305195 53/254 (21%)
TPR repeat 29..61 CDD:276937 7/32 (22%)
TPR repeat 65..102 CDD:276937 8/39 (21%)
TPR repeat 105..140 CDD:276937 10/36 (28%)
TPR repeat 144..180 CDD:276937 7/35 (20%)
alphaSnapNP_524180.1 SNAP 7..284 CDD:276937 54/270 (20%)
SNAP 7..284 CDD:291599 54/270 (20%)
TPR repeat 35..72 CDD:276937 7/36 (19%)
TPR repeat 76..112 CDD:276937 8/39 (21%)
TPR repeat 115..152 CDD:276937 10/36 (28%)
TPR repeat 156..192 CDD:276937 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.