DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaSnap2 and Y59A8B.8

DIOPT Version :9

Sequence 1:NP_649980.1 Gene:gammaSnap2 / 41239 FlyBaseID:FBgn0266721 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_507527.2 Gene:Y59A8B.8 / 180182 WormBaseID:WBGene00013345 Length:299 Species:Caenorhabditis elegans


Alignment Length:243 Identity:76/243 - (31%)
Similarity:128/243 - (52%) Gaps:8/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KAATAYRIAKSFDKRKDCLLKAIDCYENNKSWFHAAKSYEQIILLAKETDKLSEVEDYANRACCL 98
            :|:..||.|:...|....||||.:.||.|::.|||||:.|...:|.::..:.||......:|...
 Worm    43 RASVCYRNAQDPKKAAGSLLKAAEYYEQNRNLFHAAKAREGAAMLLRDIKEFSEAVVLFEKAING 107

  Fly    99 YQQHGSPEAAAAALDKAAKMTESKHPDLALGFYKRALAVVLIGDSTHQASEFASKVSRILVRLKK 163
            |.:.||.:.||..::|||.:.::.:|..||..|:|.||:|...|....||.|..:::::.::|..
 Worm   108 YAESGSLDTAAMTVEKAADVLKNDNPKEALQIYQRGLALVQQSDRAKMASNFLKQITKLSLQLTD 172

  Fly   164 YEEATKALKKEISLNLQTKSYGQVGRLVVALILVQLTLEDYVDAKKTFKKWGNRCDPQEVNT--- 225
            |:.|..::::||....:.:.|.::|:|.:.|::|.|.|||.|.|.|.: .| ..|...:..|   
 Worm   173 YKGALGSIREEIEKFAEIREYPRIGQLGIGLVIVNLALEDSVAALKDY-GW-VICQSPDFQTSED 235

  Fly   226 ---LQNLLKAFDDEDPELATKMLASPFIRHMDVEYALLSKDVPLPKGN 270
               .:||:..::..|.|....:|....:|.||.||..:.|.:..|.||
 Worm   236 GRVCENLIGFYEAGDDESFQNVLKCGALRSMDNEYLRVMKILKAPSGN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaSnap2NP_649980.1 SNAP 29..239 CDD:305195 65/210 (31%)
TPR repeat 29..61 CDD:276937 10/26 (38%)
TPR repeat 65..102 CDD:276937 11/36 (31%)
TPR repeat 105..140 CDD:276937 13/34 (38%)
TPR repeat 144..180 CDD:276937 8/35 (23%)
Y59A8B.8NP_507527.2 SNAP 9..276 CDD:305195 72/234 (31%)
TPR repeat 33..70 CDD:276937 10/26 (38%)
TPR_12 37..108 CDD:290160 22/64 (34%)
TPR repeat 74..111 CDD:276937 11/36 (31%)
TPR repeat 114..149 CDD:276937 13/34 (38%)
TPR repeat 153..189 CDD:276937 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166912
Domainoid 1 1.000 124 1.000 Domainoid score I3413
eggNOG 1 0.900 - - E1_KOG1585
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2838
Inparanoid 1 1.050 142 1.000 Inparanoid score I3057
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55184
OrthoDB 1 1.010 - - D1540214at2759
OrthoFinder 1 1.000 - - FOG0003744
OrthoInspector 1 1.000 - - mtm4851
orthoMCL 1 0.900 - - OOG6_103437
Panther 1 1.100 - - O PTHR13768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.