DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ACA5

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_172285.2 Gene:ACA5 / 837324 AraportID:AT1G08065 Length:277 Species:Arabidopsis thaliana


Alignment Length:259 Identity:69/259 - (26%)
Similarity:113/259 - (43%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKWGGLCDSGKKQSPINL--------HVKGALKGEFDALKFENYDEHQKNLRMVNNGHSIQL--- 89
            |:| .:|..|..||||:|        |..|.|:.::          ...|..:.|.||.|.:   
plant    53 PEW-AMCGKGNMQSPIDLTDKRVLIDHNLGYLRSQY----------LPSNATIKNRGHDIMMKFE 106

  Fly    90 ---SGFDHELTLSGGALLQDFVVEQIHMHWWSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKD 151
               :|..  :|::|    .::.::|||.|..||||:|..|:.||.|:||::            ||
plant   107 GGNAGLG--ITING----TEYKLQQIHWHSPSEHTLNGKRFVLEEHMVHQS------------KD 153

  Fly   152 GIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSV---------EN 207
            |...:...::....|:..:.::.:.|..            :.|:....:.|..|         ::
plant   154 GRNAVVAFFYKLGKPDYFLLTLERYLKR------------ITDTHESQEFVEMVHPRTFGFESKH 206

  Fly   208 YFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQLHNNYRELQSENNRAVVL 271
            |:.:.||||||.|:|.|.|.:..|...|||.|:...:...:|   |.::|.|.||.:|.|.|.|
plant   207 YYRFIGSLTTPPCSENVIWTISKEMRTVTLKQLIMLRVTVHD---QSNSNARPLQRKNERPVAL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 64/246 (26%)
ACA5NP_172285.2 PLN02179 9..231 CDD:177835 54/218 (25%)
alpha_CA_prokaryotic_like 44..265 CDD:239398 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H118072
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.