DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ACA4

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_193831.1 Gene:ACA4 / 827846 AraportID:AT4G20990 Length:267 Species:Arabidopsis thaliana


Alignment Length:284 Identity:77/284 - (27%)
Similarity:124/284 - (43%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSVSFSWAN-EWGYPDLDNNQDEPF---------PK-WGGL------CDSGKKQSPINLHVKGAL 59
            |.:..|:.| ...:.::|:  :.||         |: ||.:      |::|:.||||:|     .
plant    14 CFIYLSFPNISHAHSEVDD--ETPFTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDL-----T 71

  Fly    60 KGEFDALKFENYDEHQKNLRMV--NNGHSIQLS--GFDHELTLSGGALLQDFVVEQIHMHWWSEH 120
            ......:..:.:....|....|  |.||.|.:|  |...::|:.    ..||.:.|.|.|..|||
plant    72 NERVSLIHDQAWTRQYKPAPAVITNRGHDIMVSWKGDAGKMTIR----KTDFNLVQCHWHSPSEH 132

  Fly   121 TINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDS 185
            |:|..||.||:|:||.:.           :....||||||.:.. |||.:..::..:.||.    
plant   133 TVNGTRYDLELHMVHTSA-----------RGRTAVIGVLYKLGE-PNEFLTKLLNGIKAVG---- 181

  Fly   186 MNKPVLVADSLAVDDLVP-----SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKE 245
             ||.:    :|.:.|  |     ....::.|.||||.|.|.|.|.|.|:.....::::|:...::
plant   182 -NKEI----NLGMID--PREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALRQ 239

  Fly   246 IEYDEGKQLHNNYRELQSENNRAV 269
             ..|:|  ...|.|.:|....|:|
plant   240 -AVDDG--FETNSRPVQDSKGRSV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 66/232 (28%)
ACA4NP_193831.1 PLN02179 1..226 CDD:177835 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H118072
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.