DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ACA2

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001318303.1 Gene:ACA2 / 817367 AraportID:AT2G28210 Length:276 Species:Arabidopsis thaliana


Alignment Length:277 Identity:81/277 - (29%)
Similarity:117/277 - (42%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSWANEWGYPDLDNNQDEPFPKWGGL------CDSGKKQSPINL---------HVKGALKGEFDA 65
            ||:  ||       ||:....|||.|      |..|:.||||:|         |:|         
plant    39 FSY--EW-------NQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLK--------- 85

  Fly    66 LKFENYDEHQK--NLRMVNNGHSIQLSGFDHE----LTLSGGALLQDFVVEQIHMHWWSEHTIND 124
                ....|.|  |..:.|.||.:.|. |..|    :|::|    .::.:.|:|.|..||||:|.
plant    86 ----KLTRHYKPCNATLKNRGHDMMLK-FGEEGSGSITVNG----TEYKLLQLHWHSPSEHTMNG 141

  Fly   125 IRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKP 189
            .|:.||:|:||.           |....:.|:.|||.:.. |:..:|.:...|.|:...:...|.
plant   142 RRFALELHMVHE-----------NINGSLAVVTVLYKIGR-PDSFLGLLENKLSAITDQNEAEKY 194

  Fly   190 VLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQL 254
            |.|.|.   .|:......::.|.||||||.|.:.|.|.|:.:...||.:||...:...:|..   
plant   195 VDVIDP---RDIKIGSRKFYRYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNS--- 253

  Fly   255 HNNYRELQSENNRAVVL 271
            ..|.|.:|..|.|.|.|
plant   254 DTNARPVQPTNKRVVKL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 68/238 (29%)
ACA2NP_001318303.1 alpha_CA_prokaryotic_like 48..270 CDD:239398 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H118072
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.