DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and car1_predicted

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:236 Identity:81/236 - (34%)
Similarity:119/236 - (50%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QSPINLHVKGA-LKGEFDALKFENYDEHQKNLRMVNNGH--SIQLSGFDHELTLSGGALLQDFVV 109
            |||||::.:.| .......||| :||..... |:||.||  :::......:..||.|.|...:.:
 Frog    16 QSPININTRTAKYNPSLKPLKF-SYDPKTAK-RIVNVGHCFNVEFEDICDKSVLSEGPLDGHYRL 78

  Fly   110 EQIHMHW------WSEHTINDIRYPLEVHIVHRNT-IYPNMTMAANFKDGIVVIGVLYHVSNTPN 167
            .|.|.||      .|||.|:...||.|:||||.|: .|.:...||...||:.|:||...:.|| |
 Frog    79 CQFHFHWGSSDRDGSEHNIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLKLGNT-N 142

  Fly   168 EAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTET 232
            .|:.|||::|..||:    ...........::.|:|...||:||.|||||....|.||||:|.|.
 Frog   143 PALQSIIENLDKVKT----KGKACPFTEFHLNGLLPEDLNYWTYMGSLTTKPYFECVTWIILQEA 203

  Fly   233 FPVTLDQVNEFKEI----EYDEGKQLHNNYRELQSENNRAV 269
            ..|:..|:.:|:.:    |.:....:..|:|.:|..::|.|
 Frog   204 ITVSSQQLEQFRRLQCTSENENPSFILENHRPVQPLDHRVV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 80/234 (34%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.