DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CA11

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001208.2 Gene:CA11 / 770 HGNCID:1370 Length:328 Species:Homo sapiens


Alignment Length:278 Identity:72/278 - (25%)
Similarity:126/278 - (45%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WGYPD-LDNNQDEPFPKWG------GLCDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLR 79
            |.|.| |..|.....|.||      .||..||:|||:::.:|..|           ||.....||
Human    35 WSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVL-----------YDPFLPPLR 88

  Fly    80 MVNNGHSIQLSGFD---H---------ELTLSGGALLQDFVVEQIHMHW------WSEHTINDIR 126
            :...|..::.:.::   |         .:.:|||.||....:.::.:.:      .|||.||...
Human    89 LSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQG 153

  Fly   127 YPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPV 190
            :..||.::|.| .:|.|.:.|:...:|:.::.:..:|::|.|..:..:: :...:......|...
Human   154 FSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLL-NRDTITRISYKNDAY 217

  Fly   191 LVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQ-- 253
            .:.| |:::.|.|....:.||.|||:||.|:|.||||::.....:|..|::..:.:..:...|  
Human   218 FLQD-LSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIF 281

  Fly   254 --LHNNYRELQSENNRAV 269
              |..|.|.||...:||:
Human   282 QSLSGNSRPLQPLAHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 61/246 (25%)
CA11NP_001208.2 alpha_CARP_X_XI_like 48..304 CDD:239395 67/265 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..328 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145716
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.