DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CA8

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:288 Identity:81/288 - (28%)
Similarity:135/288 - (46%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EWGYPDLDNNQDEPFPKWGGLCD--SGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLRM--- 80
            ||||        |...:||.:..  :|:.||||||:.:.|           .||....::|:   
Human    28 EWGY--------EEGVEWGLVFPDANGEYQSPINLNSREA-----------RYDPSLLDVRLSPN 73

  Fly    81 ---------VNNGHSIQLSGFDHELTLSGGALLQ--DFVVEQIHMHW------WSEHTINDIRYP 128
                     .|:||:||:. ...:..||||.|.|  :|.:.::..||      .||||:|...:|
Human    74 YVVCRDCEVTNDGHTIQVI-LKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFP 137

  Fly   129 LEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHV--SNTPNEAIGSIIKSL---GAVKSYDSMN 187
            :|:|::|.| |::.::..|.....||.:|.:...:  .:...:|:..|::.:   |..|:....|
Human   138 MELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFN 202

  Fly   188 KPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLD--QVNEFKEI---- 246
            ...|:.|        |.:.:|:.|.||||.|.|:|.||||:.  .:|:|:.  |:.||:.:    
Human   203 PNTLLPD--------PLLRDYWVYEGSLTIPPCSEGVTWILF--RYPLTISQLQIEEFRRLRTHV 257

  Fly   247 ---EYDEGKQ--LHNNYRELQSENNRAV 269
               |..||..  |.:|:|..|..::|.:
Human   258 KGAELVEGCDGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 74/260 (28%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 76/273 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145779
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.