DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CA6

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:270 Identity:88/270 - (32%)
Similarity:138/270 - (51%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NEWGYPD--LDN-NQDEPFPKWGGLCDSGKKQSPINL-----HVKGALKGEFDALKFENYDEHQK 76
            ::|.|.:  ||. :..:.:|..|     |::||||||     ....:|||    |....|:....
Human    25 SDWTYSEGALDEAHWPQHYPACG-----GQRQSPINLQRTKVRYNPSLKG----LNMTGYETQAG 80

  Fly    77 NLRMVNNGHSIQLS-GFDHELTLSGGALLQDFVVEQIHMHW--------WSEHTINDIRYPLEVH 132
            ...||||||::|:| .....:|::.|.:   ::.:|:|.||        .||||::.||:.:|:|
Human    81 EFPMVNNGHTVQISLPSTMRMTVADGTV---YIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIH 142

  Fly   133 IVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTP-NEAIGSIIKSLGAVKSYDSMNKPVLVADSL 196
            |||.|:.|.:..:|.:..||:.|:.....|.|.| |....:.|..|..:| |......:   ..|
Human   143 IVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIK-YPGQRTTL---TGL 203

  Fly   197 AVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYD-EGKQLHNNYR 259
            .|.|::| ::::|:||.||||||.|.|.|.|.||.:...::..||.:.:....| ..|.:||:||
Human   204 DVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYR 268

  Fly   260 ELQSENNRAV 269
            ..|..|:|.|
Human   269 RTQPLNHRVV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 81/240 (34%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.