DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Car12

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_006511611.1 Gene:Car12 / 76459 MGIID:1923709 Length:355 Species:Mus musculus


Alignment Length:305 Identity:90/305 - (29%)
Similarity:157/305 - (51%) Gaps:46/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NEWGY--PDLDNNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGEFDA----LKFENYD-EHQKN 77
            ::|.|  |..:.|..:.:|..|||.     ||||:|| ...|  ::||    |:|:.|: ..:|.
Mouse    30 SKWTYVGPAGEKNWSKKYPSCGGLL-----QSPIDLH-SDIL--QYDASLAPLQFQGYNVSVEKL 86

  Fly    78 LRMVNNGHSIQLSGFDHELTLSGGALLQ--DFVVEQIHMHW-------WSEHTINDIRYPLEVHI 133
            |.:.|:|||::|: .:.::.:.|   ||  .:..||:|:||       .||||::...:..|:||
Mouse    87 LNLTNDGHSVRLN-LNSDMYIQG---LQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHI 147

  Fly   134 VHRNT-IYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLA 197
            ||.|: :||:.:.|::..:|:.|:.||..:.:. |.:...|...|..||   ...:.||: ....
Mouse   148 VHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSA-NPSYDKIFSHLQHVK---YKGQQVLI-PGFN 207

  Fly   198 VDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNE------FKEIEYDEGKQLH 255
            :::|:| |...|:.|.||||||.|...|.|.|......::.:|:..      |..::....:::.
Mouse   208 IEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMI 272

  Fly   256 NNYRELQSENNRAVVLVEQPEQRSGSAGLTASVSLG-LMTLILAG 299
            ||:|::|..:.|.|.:..:......:.||    ||| ::::.|||
Mouse   273 NNFRQVQKFDERLVYISFRQVGLLTNTGL----SLGIILSVALAG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 73/245 (30%)
Car12XP_006511611.1 alpha_CA 39..290 CDD:381753 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.