DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca5b

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:249 Identity:79/249 - (31%)
Similarity:129/249 - (51%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKWGGLCD--SGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLRMVNNGHS--IQLSGFDHEL 96
            |.|.|..:  .|.:|||||:.::.::.....|.....||.: ..|.:.|||:|  ::......:.
 Frog    52 PLWRGEIEVPGGSRQSPINIRIRDSVFHPQLAPVHTQYDPN-TCLYIWNNGYSFFVEYDDSTDKS 115

  Fly    97 TLSGGALLQDFVVEQIHMHW-----W-SEHTINDIRYPLEVHIVHRN-TIYPNMTMAANFKDGIV 154
            |:|||.|...|.::|.|.||     | ||||::...:|.|:|:||.| :.|.....|....:|:.
 Frog   116 TVSGGPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWNCSKYRTFEEAIMEPNGLA 180

  Fly   155 VIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPT 219
            ||||...|.. .:|.:..::..|.:|:..|::.:......|.    |:||..:|:||:||||||.
 Frog   181 VIGVFLKVGK-HHEKLQKLVDILPSVRYKDALTEFNYFDSSC----LLPSCGDYWTYSGSLTTPP 240

  Fly   220 CAEAVTWIVLTETFPVTLDQVNEFKEIEY----DEGKQLHNNYRELQSENNRAV 269
            ..|:||||::.:...|...|:..|:.:.:    :|.:.:.:|:|.||...||.|
 Frog   241 LTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFRPLQPLMNRTV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 75/236 (32%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.