DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Car10

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001348636.1 Gene:Car10 / 72605 MGIID:1919855 Length:328 Species:Mus musculus


Alignment Length:300 Identity:76/300 - (25%)
Similarity:139/300 - (46%) Gaps:41/300 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLIALSLIVCCS-------VSFSWANEWGYPDLDNNQDEPFPK-WG------GLCDSGKKQSPI 51
            :.|:..:.|||.|       :...|   |.|.::......|.|. ||      .||..||:|||:
Mouse     8 LFLLQANFIVCISAQQNSPKIHEGW---WAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPV 69

  Fly    52 NLHVKGALKGEFDALKFENYDEHQKNLRMVNNGHSIQLS-GFDHELTLSGGALLQDFVVEQIHMH 115
            |:.....:...|......|....:.:..|.|.|..:.|. ..:|.:.:|||.:.....:|:|.:|
Mouse    70 NIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLH 134

  Fly   116 W------WSEHTINDIRYPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSI 173
            :      .|||.:|...:..||.::|.| .:|.|:|.||...:|:||:.:...||::.|..:..:
Mouse   135 FGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRM 199

  Fly   174 IKSLGAVKSYDSMNKPVLVADS-----LAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETF 233
            :       :.|::.:.....|:     |.:::|.|...::.||.||:|.|.|.|..:||::.:..
Mouse   200 L-------NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPV 257

  Fly   234 PVTLDQVNEFKEIEYDEGKQ----LHNNYRELQSENNRAV 269
            .:|..|::..:.:..::..|    :.:|:|.:|..|||.:
Mouse   258 YITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 62/240 (26%)
Car10NP_001348636.1 alpha_CARP_X_XI_like 46..302 CDD:239395 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835842
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.