DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and PTPRG

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens


Alignment Length:288 Identity:77/288 - (26%)
Similarity:118/288 - (40%) Gaps:73/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKKQSPINLHVKGALKG-EFDALKFENYDEHQKNLR-MVNNGHSIQLSGFDHELTLSGGALLQDF 107
            |:.||||::..:.|..| |:..|:.:.:|....|.. |.|.|.::.:...| :..:||..|...|
Human    80 GRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKD-DYFVSGAGLPGRF 143

  Fly   108 VVEQIHMHW-------WSEHTINDIRYPLEVHIVHRN---------------------------- 137
            ..|::..||       .|||:||..|:|:|.......                            
Human   144 KAEKVEFHWGHSNGSAGSEHSINGRRFPVEAEDARGGDIMLMLSQGMRFILLGLKKEQFEERKSW 208

  Fly   138 TIYPNMTM-------AANFKDGIV---VIG---VLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKP 189
            |.|.:|.:       ..:|:..|.   :||   :.:.||...|.|:..||..|..|..::...  
Human   209 TTYQSMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKET-- 271

  Fly   190 VLVADSLAVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEF---------- 243
              ..|...:.||:| |:.:|:.|.||||||.|:|.|.|||.....|::..|:..|          
Human   272 --FLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQD 334

  Fly   244 --KEIEYDEGKQLHNNYRELQSENNRAV 269
              |.:||     |.||:|..|..::|.|
Human   335 HVKSVEY-----LRNNFRPQQRLHDRVV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 76/286 (27%)
PTPRGXP_016862450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.