DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca9

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_009303384.1 Gene:ca9 / 566612 ZFINID:ZDB-GENE-080818-5 Length:384 Species:Danio rerio


Alignment Length:292 Identity:90/292 - (30%)
Similarity:141/292 - (48%) Gaps:52/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SWANEWGYPDLDNNQDEPFPKWGGLCD--SGKKQSPINLHVKGAL-KGEFDALKFENYD---EHQ 75
            |..:.|||.|.|        .|....:  .||.|||||:.....| :.....::.:.||   .| 
Zfish    39 SHQHHWGYQDQD--------AWLSAFEHCGGKSQSPINIDTHKVLHEPRLPPIQLDGYDLTGSH- 94

  Fly    76 KNLRMVNNGHSIQLS---------GFDHELTLSGGALLQDFVVEQIHMHW------WSEHTINDI 125
             :|.::||||::|||         |||           |.:|..|:|.||      .|||||::|
Zfish    95 -SLTLLNNGHTLQLSLPSSMRIRRGFD-----------QVYVAAQLHFHWGTTEVPGSEHTIDNI 147

  Fly   126 RYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPV 190
            .||.|:|:||.|:.|.|:|.||:..||:.|:|....:....|:....|:.:|..|.:.:|:.   
Zfish   148 HYPAEIHVVHYNSKYANLTEAASKADGLAVLGGFIAIGLHENDNYEKILSALSDVSTEESLT--- 209

  Fly   191 LVADSLAVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKE-IEYDEGKQ 253
             |.....|..|:| |:|.::.|:||||||.|.:.|:|.:..::..|:..|:...:| ::.:..|.
Zfish   210 -VIPGFNVRHLLPNSLERFYRYSGSLTTPPCLQTVSWTLFNDSIRVSRRQLAALEESLKTEHNKL 273

  Fly   254 LHNNYRELQSENNRAVVLVEQPEQRSGSAGLT 285
            |..|:|..|..:.|.:    |....:..:|.|
Zfish   274 LSKNFRAPQLLHGRKI----QSSFHTSDSGKT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 80/244 (33%)
ca9XP_009303384.1 alpha_CA_IX 48..294 CDD:239403 84/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.