DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca4b

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001159683.1 Gene:ca4b / 553246 ZFINID:ZDB-GENE-080815-5 Length:304 Species:Danio rerio


Alignment Length:294 Identity:86/294 - (29%)
Similarity:147/294 - (50%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLIALS-LIVCCSVSFSWANEWGY-------------PDLDNNQDEPFPKWGGLCDS--GKKQS 49
            |:.:.|| |.:.|.::.|  .||.|             ||          .|..:..:  ..|||
Zfish     1 MNFLCLSTLAILCRLASS--AEWCYQTQVTCSNHSCIGPD----------DWATVAAACGNNKQS 53

  Fly    50 PINLHV-KGALKGEFDALKFENYDEHQKNLRMVNNGHSIQLSGFDHELTLSGGALLQDFVVEQIH 113
            |||:.. |.:.......::|.:|.| :.|..:|||||::|:: ......::|..|...:..:|:|
Zfish    54 PINIVTNKASTDSRLTPVQFTDYQE-RLNAVIVNNGHTVQIN-LPDRAKINGANLGSTYKAQQLH 116

  Fly   114 MHW------WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGS 172
            :||      .|||||:..::|:|:|:||....|.::..|.....|:.|:|..|..|...|:...:
Zfish   117 LHWGKNGGPGSEHTIDGEKFPMELHVVHIKEEYNSLEQAVGDSSGVAVLGFFYEESENANKNYDA 181

  Fly   173 IIKSLGAVKSYDSMNKPVLVADSLAVDDLVPS--VENYFTYAGSLTTPTCAEAVTWIVLTETFPV 235
            ||.||..:...:|..:    ..::::|.|:|:  ::.||.|.||||||.|||||.|.:..:|.|:
Zfish   182 IINSLTNITHPESNAE----LGAISLDMLIPNEDLDKYFRYEGSLTTPGCAEAVVWTIFEKTIPL 242

  Fly   236 TLDQVNEFKEIEYDEGKQLHNNYRELQSENNRAV 269
            :.:|::.|..:.:.:|..:.|.:|.:|...:|.|
Zfish   243 SKEQLSAFSNLTFSDGAAMVNTFRPIQLRFDRPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 73/232 (31%)
ca4bNP_001159683.1 alpha_CA_IV_XV_like 50..278 CDD:239391 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.