DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca8

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001017571.2 Gene:ca8 / 550233 ZFINID:ZDB-GENE-050417-26 Length:281 Species:Danio rerio


Alignment Length:288 Identity:80/288 - (27%)
Similarity:136/288 - (47%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EWGYPDLDNNQDEPFPKWGGLCD--SGKKQSPINLHVKGALKGEFDALKFENYDEHQ-------- 75
            :|||        |...:||.|..  :|:.||||||:.:.|           .||...        
Zfish    19 DWGY--------EEGVEWGLLFPEANGEYQSPINLNSREA-----------RYDPQLLDVGLNPN 64

  Fly    76 ----KNLRMVNNGHSIQLSGFDHELTLSGGALLQD--FVVEQIHMHW------WSEHTINDIRYP 128
                ::..::|:||::::. ...:..::||.|..|  :.:.::..||      .||||:|...:|
Zfish    65 YVVCRDCEVINDGHTVRIM-LKSKSVVTGGPLPSDHEYELSEVRFHWGKENQRGSEHTVNFKAFP 128

  Fly   129 LEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHV--SNTPNEAIGSIIKSL---GAVKSYDSMN 187
            :|:|::|.| |::.::..|...|.||::|.:...|  .:...:||..:::.|   |..|.....|
Zfish   129 MELHLIHWNSTLFNSVEEAMGKKRGILIIALFVQVGKEHLGLKAITDVLQDLQYKGKTKIIPCFN 193

  Fly   188 KPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLD--QVNEFKEI---- 246
            ...|:.|        |.:.:|:.|.||||||.|:|.||||:.  .:|:|:.  |:.||:.:    
Zfish   194 PNTLLPD--------PLLRDYWVYEGSLTTPPCSENVTWILY--RYPLTISQMQIEEFRRLRSHV 248

  Fly   247 ---EYDEGK--QLHNNYRELQSENNRAV 269
               |..||.  .|.:|:|..|..::|.|
Zfish   249 KGAELPEGNDGMLGDNFRPTQPLSDRVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 72/260 (28%)
ca8NP_001017571.2 alpha_CARP_VIII 25..280 CDD:239394 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.