DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca7

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:272 Identity:87/272 - (31%)
Similarity:130/272 - (47%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WGYPDLDNNQD--EPFPKWGGLCDSGKKQSPINLHVKGAL-KGEFDALKFENYDEHQKNLRMVNN 83
            |||.:.|...:  ..||     ...|.:||||::....|: ....:.|.. :|| |..::.:.||
 Frog     7 WGYGEEDGPSEWHHYFP-----IAEGNRQSPIDIVSNQAVFNPSLNPLVI-SYD-HCTSINLSNN 64

  Fly    84 GHS--IQLSGFDHELTLSGGALLQDFVVEQIHMHW------WSEHTINDIRYPLEVHIVHRNT-I 139
            |||  ::...:|.:..::||.|...:.::|.|.||      .||||::...||.|:|:||.|. .
 Frog    65 GHSVMVEFDDYDDKTVITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARA 129

  Fly   140 YPNMTMAANFKDGIVVIGVLYHVS------NTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAV 198
            |.:...||...||:|||||.....      |...:|: .::|..|....:|..|...        
 Frog   130 YSSFGEAAAAPDGLVVIGVFLETGGQHSGLNRLTDAL-YMVKFKGTKTQFDDFNPKC-------- 185

  Fly   199 DDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEI----EYDEGKQLH--NN 257
              |:||...|:||.||||||...|:||||||.|...|:..|:..|::.    ..:|.:::|  ||
 Frog   186 --LLPSSFEYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIHMVNN 248

  Fly   258 YRELQSENNRAV 269
            :|..|....|.|
 Frog   249 FRPPQPLKGRKV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 80/245 (33%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.