DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Ca3

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_062165.2 Gene:Ca3 / 54232 RGDID:2241 Length:260 Species:Rattus norvegicus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:117/279 - (41%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANEWGYPDLDNNQDEPFPKWGGL--CDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLR-- 79
            |.||||  ..:|..|   .|..|  ...|..||||.||.|..              .|..:|:  
  Rat     2 AKEWGY--ASHNGPE---HWHELYPIAKGDNQSPIELHTKDI--------------RHDPSLQPW 47

  Fly    80 -----------MVNNGHSIQL---SGFDHELTLSGGALLQDFVVEQIHMHW------WSEHTIND 124
                       ::|||.:.::   ..||..: |.||.|...:.:.|.|:||      .||||::.
  Rat    48 SVSYDPGSAKTILNNGKTCRVVFDDTFDRSM-LRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDG 111

  Fly   125 IRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKP 189
            ::|..|:|:||.|..|.....|....|||.|:|:...:.....| ...::.:|..:|: .....|
  Rat   112 VKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGE-FQILLDALDKIKT-KGKEAP 174

  Fly   190 VLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNE----FKEIEYDE 250
            ....|...   |.|:..:|:||.||.|||.|.|.:.|::|.|...|:.||:.:    |...|.:.
  Rat   175 FNHFDPSC---LFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFASAENEP 236

  Fly   251 GKQLHNNYRELQSENNRAV 269
            ...|..|:|..|....|.|
  Rat   237 PVPLVGNWRPPQPIKGRVV 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 70/249 (28%)
Ca3NP_062165.2 alpha_CA_I_II_III_XIII 1..259 CDD:239393 80/279 (29%)
Involved in proton transfer. /evidence=ECO:0000250 64..67 0/2 (0%)