DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Car2

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_062164.1 Gene:Car2 / 54231 RGDID:2240 Length:260 Species:Rattus norvegicus


Alignment Length:287 Identity:78/287 - (27%)
Similarity:131/287 - (45%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANEWGYPDLD--NNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLR-- 79
            ::.|||...:  .|..:.||     ..:|.:|||:::....|              :|..:|:  
  Rat     2 SHHWGYSKSNGPENWHKEFP-----IANGDRQSPVDIDTGTA--------------QHDPSLQPL 47

  Fly    80 -----------MVNNGHSIQLSGFDHE--LTLSGGALLQDFVVEQIHMHW------WSEHTINDI 125
                       :||||||..:...|.:  ..|..|.|...:.:.|.|.||      .||||:|..
  Rat    48 LICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKK 112

  Fly   126 RYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVK--------- 181
            :|..|:|:||.||.|.:...|....||:.|:|:...: ...::.:..|.::|.::|         
  Rat   113 KYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKI-GPASQGLQKITEALHSIKTKGKRAAFA 176

  Fly   182 SYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEI 246
            ::|..:             |:|...:|:||.||||||...|.||||||.|...|:.:|::.|:::
  Rat   177 NFDPCS-------------LLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKL 228

  Fly   247 EYD-EGKQ---LHNNYRELQSENNRAV 269
            .:: ||:.   :.:|:|..|...||.:
  Rat   229 NFNSEGEAEELMVDNWRPAQPLKNRKI 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 72/257 (28%)
Car2NP_062164.1 alpha_CA 1..259 CDD:294017 78/287 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 7/41 (17%)