DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CAH16

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster


Alignment Length:268 Identity:102/268 - (38%)
Similarity:137/268 - (51%) Gaps:32/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EWGYPDLDNNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKN-LRMVNNG 84
            ||.|  |.|.:|     |..||.|||.||||.|..:.|.|.....:.|.:|....|. ..:.|||
  Fly    25 EWNY--LKNGKD-----WEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNG 82

  Fly    85 HSIQLSGFDHELT-------LSGGALLQDFVVEQIHMHW------WSEHTINDIRYPLEVHIVHR 136
            |||.|   |..:|       ::||.|...:..:.:|.||      .|||.||..|:..|:|||||
  Fly    83 HSISL---DIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHR 144

  Fly   137 NTIYPNMTMAANFKDGIVVIGVLYHV---SNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAV 198
            |..|.|:..|...|||:.|:.::..:   .|..:..:..:::::..|...|| |..|....||  
  Fly   145 NEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDS-NATVFGQSSL-- 206

  Fly   199 DDLVPSV--ENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQLHNNYREL 261
            |.|:..|  .::|||.||||||.|.|.|||||.|||..||:..|::|..:....|.:|.||||.:
  Fly   207 DQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIV 271

  Fly   262 QSENNRAV 269
            |..|||.|
  Fly   272 QDLNNRTV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 91/242 (38%)
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 99/264 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446794
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.