DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca8

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:276 Identity:76/276 - (27%)
Similarity:128/276 - (46%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EWGYPDLDNNQDEPFPKWGGLCD--SGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLRM--- 80
            ||||        |...:||.|..  :|..|||||::.:.|:           ||.....:|:   
 Frog    20 EWGY--------EEGVEWGLLYPEANGDYQSPININSREAM-----------YDPSLLEVRLTPS 65

  Fly    81 ---------VNNGHSIQLSGFDHELTLSGGALLQ--DFVVEQIHMHW------WSEHTINDIRYP 128
                     :|:||.:|:. ...:..|.||.|.:  ::.:.::..||      .||||:|...:|
 Frog    66 YVVCRDCEVINDGHVVQIL-LKSKSVLKGGPLPRGHEYELNEVRFHWGKENQRGSEHTVNFKAFP 129

  Fly   129 LEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHV--SNTPNEAIGSIIKSL---GAVKSYDSMN 187
            :|:|::|.| |:|.::..|.....|||:|.:...:  .|...:||..:::.:   |..|:....|
 Frog   130 MELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQIGKENIGLKAITEVLQDIFYKGKSKTIPCFN 194

  Fly   188 KPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIE-YDEG 251
            ...|:.|        |.:.:|:.|.||||.|.|:|.||||:......|:..|:.||:.:. :.:|
 Frog   195 PNTLLPD--------PLLRDYWVYEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRRLRTHIKG 251

  Fly   252 KQLHNNYRELQSENNR 267
            ..|.:....|.::|.|
 Frog   252 ADLPDGCDGLMADNFR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 68/250 (27%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.