DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca2

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_954685.2 Gene:ca2 / 387526 ZFINID:ZDB-GENE-031219-5 Length:260 Species:Danio rerio


Alignment Length:272 Identity:94/272 - (34%)
Similarity:139/272 - (51%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANEWGYPDLDNNQDEPFPKWGGL--CDSGKKQSPINLHVKGALKGE-FDALKFENYDEHQKNLRM 80
            |:.||| |..|..|    |||..  ..:|.:||||::........| ...||.: ||. ..:|.:
Zfish     2 ADHWGY-DKHNGPD----KWGESYPIANGSRQSPIDIKSSTTTYDEKLTPLKLK-YDP-STSLDI 59

  Fly    81 VNNGHSIQLSGFD--HELTLSGGALLQDFVVEQIHMHW------WSEHTINDIRYPLEVHIVHRN 137
            .|||||.|:|..|  :..||:||.:...|.::|.|.||      .||||:|...||.|:|:||.|
Zfish    60 QNNGHSFQVSFVDDQNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWN 124

  Fly   138 TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKS------YDSMNKPVLVADSL 196
            |.||:...|.:..||:.|:||...: ...|..:..|:.::.|:||      :.:.:..||:..||
Zfish   125 TKYPSFKDAVDKPDGLAVVGVFLKI-GADNPKLQKILDAMDAIKSKGKQTPFPNFDPSVLLPSSL 188

  Fly   197 AVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYD-EGKQ---LHNN 257
                      :|:||.||||||...|:|||||..::..|:..|:..|:.:.:. :|::   :.||
Zfish   189 ----------DYWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNN 243

  Fly   258 YRELQSENNRAV 269
            ||..|....|.|
Zfish   244 YRPPQPLKGRVV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 83/242 (34%)
ca2NP_954685.2 alpha_CA 1..259 CDD:320708 94/272 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.