DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CAH14

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:101/237 - (42%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKQSPINLHVKGALKGEFDALKFENYDEHQKNLRMV----NNGHSIQL-----SGFDHELTLSGG 101
            |:.|||.:.....:|.:   ||...:..:.::|.|.    |||:::.:     :.|..:  |||.
  Fly    71 KQPSPITIPESNMIKRQ---LKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQ--LSGA 130

  Fly   102 ALLQDFVVEQIHMHWW---SEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVS 163
            .||..:...:....|.   |||:|....:.||:..:||.....|     ||:  .:.:..|:.:|
  Fly   131 ELLGRYQFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNN-----NFE--YLTLSYLFALS 188

  Fly   164 NTPNEAIGSIIKSLGAV-KSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWI 227
            :..||.:..:...|..: :...|:..|....:||    |.|....||:|.|:..........||:
  Fly   189 HVKNEHLKQVTDHLKWISQPGSSIELPPFHLESL----LQPFGSGYFSYEGTYDNGDVVLPTTWL 249

  Fly   228 VLTETFPVTLDQVNEFKEIEYDEGKQLHNNYRELQSENNRAV 269
            :..:...|...|::||:.:....|.:...|.||.|...||.|
  Fly   250 INRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 58/235 (25%)
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 59/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.