DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CAH13

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:277 Identity:68/277 - (24%)
Similarity:132/277 - (47%) Gaps:29/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVSFSWANEWGYPDLDNNQDEPFPKWGGLCDSGKK----QSPINLH----VKGALKGEFDALKFE 69
            |.|.:.|..:|| |:.:......||......|.::    |||:|:.    .:.|::   :.|.:.
  Fly    74 SCSRNSAPVYGY-DMQHGPHTWLPKSRSSSSSVEEATFFQSPVNIDESQIQRMAIR---ELLSWN 134

  Fly    70 NYDEHQKNLRMVNNGHSIQLSGFDH--ELTLSGGALLQDFVVEQIHMHW-W-----SEHTINDIR 126
            :||:...::.:.|.|.::.|....|  ..|:||..||..:...::..|| |     ||||||..:
  Fly   135 HYDDLPASITLENTGQTLILRAQFHGNAPTISGADLLASYTFLELRFHWGWCNSEGSEHTINHRK 199

  Fly   127 YPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVL 191
            :|||:.::|:.......|..:::  .:::||.::.:| ..|..:..::::|..|:   ...|.|.
  Fly   200 FPLEMQVMHKTGSGIPRTCTSSY--DLLMIGYVFELS-AHNPFLDPLVQNLRLVQ---KPGKRVQ 258

  Fly   192 VADSLAVDDLVPSVEN-YFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEG-KQL 254
            :: ...:..|:....: :::|.||||.|.|.:...|.:..|:..::..|:..|:.:...:| ..:
  Fly   259 IS-PFPISYLMYQFRSGFYSYGGSLTHPPCYQGTEWFIFPESLAISDFQLRHFRLLLGPDGISPI 322

  Fly   255 HNNYRELQSENNRAVVL 271
            ..|.|.:|...||.|.|
  Fly   323 ARNSRPVQHMGNRVVSL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 57/241 (24%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 61/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.