DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and CAH3

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster


Alignment Length:241 Identity:76/241 - (31%)
Similarity:113/241 - (46%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QSPINL------HVKGALKGEFDALKFENYDEHQKNLRMVNNGHS--IQLSGFDHELTLSGGALL 104
            ||||.:      |:     .:.|.|::..:.|.....|:.|.|.|  :..|....:..:.||||.
  Fly     4 QSPIEISNRAIEHI-----DDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALE 63

  Fly   105 QD-FVVEQIHMHW------WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHV 162
            || :|.||:|.||      ..|||:..::|.:|.|.||.|:.|.:.|.|.|..||:.|:......
  Fly    64 QDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQA 128

  Fly   163 SNTPN--------EAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPT 219
            ....:        |.| .|::.:....|.||        |.|:...|....::|:||.|||||..
  Fly   129 CGEKDCPEFKKITEGI-RIVQKIHTSASLDS--------DCLSWIGLQELSKHYYTYKGSLTTAP 184

  Fly   220 CAEAVTWIVLTETFPVTLDQVNEFKEIE---YDEGKQLHNNYRELQ 262
            ..|:||||:......|:..||..|:.::   .||.|::.|||||:|
  Fly   185 YFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 76/241 (32%)
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.