DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Ca9

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:294 Identity:81/294 - (27%)
Similarity:133/294 - (45%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FPKWGGLCDSGKKQSPINLHVK-GALKGEFDALKFENYD-EHQKNLRMVNNGHSIQLSGFDHELT 97
            :|:....| :|:.|||:::.:: .:.......|:...|: :....|.:.||||::|       ||
  Rat   128 WPQVSPAC-AGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPELSLCNNGHTVQ-------LT 184

  Fly    98 LSGGALL-----QDFVVEQIHMHW------WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKD 151
            |..|..:     |::...|:|:||      .||||:|..|:|.|:|:||.:|.:..:..|.....
  Rat   185 LPPGLKMVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSELHEALGRPG 249

  Fly   152 GIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPS-VENYFTYAGSL 215
            |:.|:......|...|.|...::..|..:....|.    :....|.|..|:|| :..|:.|.|||
  Rat   250 GLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSK----IEIPGLDVSALLPSDLSRYYRYEGSL 310

  Fly   216 TTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYD-EGKQLHNNYRELQSENNRAV------VLVE 273
            |||.|::.|.|.|..||..::..|::......:. ...:|..|:|..|..|.|.:      |...
  Rat   311 TTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPLNGRTIEASFPAVADS 375

  Fly   274 QPEQRSGSAGLTASVSLGLM-TLILAGQK--FLL 304
            .||....::.|:|...|.|: .|:.|...  |||
  Rat   376 SPEPVHVNSCLSAGDILALVFGLLFAATSIAFLL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 67/238 (28%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339484
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.