DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Ca11

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:278 Identity:70/278 - (25%)
Similarity:123/278 - (44%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WGYPD-LDNNQDEPFPKWG------GLCDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLR 79
            |.|.: |..|.....|.||      .||..||:|||:::.:|..|           ||.....||
  Rat    35 WSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVL-----------YDPFLPPLR 88

  Fly    80 MVNNGHSIQ------------LSGFDHELTLSGGALLQDFVVEQIHMHW------WSEHTINDIR 126
            :...|..::            |......:.:|||.||....:.::.:.:      .|||.||...
  Rat    89 LSTGGEKLRGTLYNTGRHVSFLPASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQG 153

  Fly   127 YPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPV 190
            :..||.::|.| .:|.|::.|:...:|:.::.:..:|:.:.|..:..:: :...:......|...
  Rat   154 FSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLL-NRDTITRISYKNDAY 217

  Fly   191 LVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQ-- 253
            .:.| |:::.|.|....:.||.|||:||.|:|.||||::.....:|..|::..:.:..:...|  
  Rat   218 FLQD-LSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIF 281

  Fly   254 --LHNNYRELQSENNRAV 269
              |..|.|.||...:||:
  Rat   282 QSLSGNGRPLQPLAHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 60/246 (24%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 66/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.