DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Ca6

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001128313.1 Gene:Ca6 / 298657 RGDID:70516 Length:312 Species:Rattus norvegicus


Alignment Length:287 Identity:83/287 - (28%)
Similarity:136/287 - (47%) Gaps:37/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IALSLIVCCSVSFSWANEWGYPDLDNNQDEPFPKWGGLCDSGKKQSPIN-----LHVKGALKGEF 63
            :.:|::....:.....:||.|...|..::..:|:....| .|::||||:     :|...:|.   
  Rat     3 VLVSVVSLFFLGIQALSEWSYSGDDGLEESRWPEKYPSC-GGERQSPIDVKRREVHFSSSLL--- 63

  Fly    64 DALKFENYDEHQKNLRMVNNGHSIQLSGFDHELTLSGGALLQD-----FVVEQIHMHW------- 116
             .|...||:|....|.|.||||::|       :||.....::|     :..:|:|.||       
  Rat    64 -PLHMVNYEEEGLELSMTNNGHTVQ-------ITLPNTMSMRDSDGTVYRTKQMHFHWGGRDSEI 120

  Fly   117 -WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSN-TPNEAIGSIIKSLGA 179
             .|||||:.:|:.:|:|:||.|..|.....|.:..||:.|:.||..|.: |.|:...:.|..|..
  Rat   121 SGSEHTIDGMRHAIEIHLVHFNEKYETYEKAVDQPDGLAVMAVLVKVEDYTENDYYSTFISELEN 185

  Fly   180 VKSYDSMNKPVLVADSLAVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEF 243
            || |......:   .::.:.:::| .:.:|:||.||||||.|.|.|.|.|..::..::..|....
  Rat   186 VK-YTGQTTTL---RNVNIRNMLPGDIRHYYTYQGSLTTPPCTENVKWFVFQDSATISKAQAERI 246

  Fly   244 KEIEYDEGKQ-LHNNYRELQSENNRAV 269
            :....|...| :.|.||..|..:||.|
  Rat   247 ENAVMDHHNQTIRNGYRRTQPLHNRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 75/244 (31%)
Ca6NP_001128313.1 alpha_CA_VI 30..278 CDD:239399 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.