DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Car15

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:298 Identity:85/298 - (28%)
Similarity:139/298 - (46%) Gaps:48/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WGYPDLDNNQDEPFPK-----WGGLCDS--GKKQSPINLHVKGALKGEFDALK---FENYDE-HQ 75
            |.|    ::||   ||     |..|..:  |..|||:|:.:: .::.:: |||   |..||. .|
  Rat    24 WCY----DSQD---PKCGPAHWKELAPACGGPTQSPVNIDLR-LVQRDY-ALKPFIFHGYDSAPQ 79

  Fly    76 KNLRMVNNGHSIQL---SGFDHELTLSGGAL-LQDFVVEQIHMHW------WSEHTINDIRYPLE 130
            ....:.|:||::.|   |...:...:.|..| ..::.:.|:|.||      .|||::::....:|
  Rat    80 DPWILENDGHTVLLRVHSCQQNCPAIRGAGLPSSEYRLLQLHFHWGSPGHKGSEHSVDEKHGSME 144

  Fly   131 VHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADS 195
            :|:||.||.|.:|..|.:..||:.::.||....:..|....:|:..|   |:..|....|.:..:
  Rat   145 MHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKDNTNFSAIVSGL---KNVSSPGVSVNLTST 206

  Fly   196 LAVDDLVPS---VENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQLH-- 255
            .|:..|:||   :..|:.|:||||||.|..||.|.|...|.|:...||.:|:.:.......||  
  Rat   207 FALASLLPSALGLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQVVQFQAVPQTGPPGLHPR 271

  Fly   256 ---NNYRELQSENNRAVVLVEQPEQRSGSAGLTASVSL 290
               :|:|..|....|.:       ..|..|.:.:||.:
  Rat   272 PLTDNFRPQQPLGGRRI-------SASPGASIRSSVPI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 73/245 (30%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.