DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and cah-4

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:257 Identity:68/257 - (26%)
Similarity:106/257 - (41%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGKKQSPINL---HV---KGALKGEFDALKFENYDEHQKNLRMVNNGHSIQLSGFDHELTLSGGA 102
            :.::||||::   ||   ....|.  |||..: |........:|:.|      ||...:..:.|.
 Worm    48 AAQRQSPIDIVPQHVCCDTDVCKA--DALNID-YKSGDCCDVLVSEG------GFLVNVKRNCGT 103

  Fly   103 LL-------QDFVVEQIHMHW------WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIV 154
            .|       ..|.:.|.|.||      .|||.::..:...|||.|..||.|.:..:|.:..||:.
 Worm   104 FLTANHLPSSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWNTSYESFNVALSKPDGLA 168

  Fly   155 VIGVL---------YH-VSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVE--N 207
            |:||.         || :.:|..:|.|:.              .|:.:.....::.|:||.:  .
 Worm   169 VVGVFLKEGKYNDNYHGLIDTVRKATGNA--------------TPIAMPKDFHIEHLLPSPDKRE 219

  Fly   208 YFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQLHNNYRELQSENNRAV 269
            :.||.||||||...|.|.|.:.||...|:..|:|..:.|       :..|:|..|...:|.:
 Worm   220 FVTYLGSLTTPPYNECVIWTLFTEPVEVSFGQLNVLRNI-------IPANHRACQDRCDREI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 68/254 (27%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.