DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and cah-5

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:292 Identity:87/292 - (29%)
Similarity:134/292 - (45%) Gaps:43/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HLIALSLIVCCSVSFSWA----NEWGYPDLDNNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGE 62
            ||:.|||:|...|..|..    :.||| |.:|..|    .|.|.|.:..|||||::.........
 Worm     4 HLLVLSLLVALLVVVSCGPGSDHGWGY-DENNGPD----TWQGKCQNHLKQSPIDIRAPDVDYAL 63

  Fly    63 FDALKFENYDEHQKNLRMVNNGHSIQLSGFD----HELTLSGGALLQDFVVEQIHMHW------W 117
            ...:.|.|||...| :.:.|.|.::...||:    .:..:.||.|...:.:.|.|:||      .
 Worm    64 LHRMHFLNYDMDGK-IELSNTGRTLFAGGFESWQHKQPMIQGGGLKHRYKLAQFHLHWGQNDAVG 127

  Fly   118 SEHTINDIRYPLEVHIVHRNTIYPNMTM--AANFKDGIVVIGVLYHVSNTP--------NEAIGS 172
            |||.:..:.||.|:|:||   :...:|:  |.:..||:.|:||....:|.|        :|.:..
 Worm   128 SEHAMGSLHYPAELHLVH---VREGLTLKEALSRPDGLAVVGVFLAKTNDPVANKFSPISERLHD 189

  Fly   173 IIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTL 237
            :..|....:..:...|.||..|:          |.::.|.||||||.|:|||.|.||.|...::.
 Worm   190 LRHSGNKTELKNFRTKYVLPLDT----------EAFYRYEGSLTTPDCSEAVIWTVLAEPMAISS 244

  Fly   238 DQVNEFKEIEYDEGKQLHNNYRELQSENNRAV 269
            .|::..:::...|..:...|||.||..|.|.:
 Worm   245 HQLHLLRQLHNKELVKSDKNYRPLQPLNGRRI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 70/243 (29%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm8413
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - LDO PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.