DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and cah-2

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_495567.3 Gene:cah-2 / 174218 WormBaseID:WBGene00000280 Length:337 Species:Caenorhabditis elegans


Alignment Length:269 Identity:67/269 - (24%)
Similarity:120/269 - (44%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WG------GLCDSGKKQSPINLHVKGALKGEFDALKFENYDEHQKNLRMVNNGHSIQLSGFDH-- 94
            ||      .:|.:|:.|||:|:.....|           ||.|   |..:|...:|..:.|::  
 Worm    20 WGLLHGDWRMCTAGQMQSPVNIDPSQLL-----------YDPH---LMPINIEGNIVEAVFENTG 70

  Fly    95 --------------ELTLSGGALL-QDFVVEQIHMHW--------WSEHTINDIRYPLEVHIV-H 135
                          .:.::||..: ..:.:.||.:|:        .||||::.:|:|.|:.:: :
 Worm    71 QLPVVTVKDLPNRPTINITGGPTMPYRYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAY 135

  Fly   136 RNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDD 200
            .:.:|||.::|.....|::.:.|:..:..|.:..:..:..   |.:|.:...:...:.| .....
 Worm   136 NSALYPNFSVAMTSPRGLLAVSVIVDIGKTTSVELRRLTV---ASQSINYKGQTTNLTD-FQPSA 196

  Fly   201 LVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQ-----LHNNYRE 260
            |:|...:|.||.||||.|.|.|.|||::|.....:|.|.:..:.|::..|.||     :...||.
 Worm   197 LLPKTSHYVTYEGSLTFPGCHETVTWVILNNPIYITNDDLQIWNEMQKTETKQPEPSYMTPAYRP 261

  Fly   261 LQSENNRAV 269
            |:|.|.|.|
 Worm   262 LKSLNGRLV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 63/254 (25%)
cah-2NP_495567.3 alpha_CARP_X_XI_like 16..275 CDD:239395 67/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.