DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Ptprg

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:248 Identity:74/248 - (29%)
Similarity:114/248 - (45%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKKQSPINLHVKGALKG-EFDALKFENYDEHQKNLR-MVNNGHSIQLSGFDHELTLSGGALLQDF 107
            |..||||::....|..| |:..|:.:.:|....|.. |.|.|.::.:...| :..:||..|...|
  Rat    80 GSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKD-DYFVSGAGLPGRF 143

  Fly   108 VVEQIHMHW-------WSEHTINDIRYPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSN 164
            ..|::..||       .|||::|..|:|:|:.|...| ..:.:...|.:....|..:.:.:.||.
  Rat   144 KAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSP 208

  Fly   165 TPNEAIGSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIV 228
            ..|.|:..||..|..|..::...    ..|...:.||:| |:.:|:.|.||||||.|:|.|.|||
  Rat   209 RDNSALDPIIHGLKGVVHHEKET----FLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIV 269

  Fly   229 LTETFPVTLDQVNEF------------KEIEYDEGKQLHNNYRELQSENNRAV 269
            .....|::..|:..|            |.:||     |.||:|..|:.|:|.|
  Rat   270 FRRPVPISYHQLEAFYSIFTTEQQDHVKSVEY-----LRNNFRPQQALNDRVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 73/246 (30%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 74/248 (30%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.