DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and si:ch211-173d10.4

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_021336146.1 Gene:si:ch211-173d10.4 / 108191769 ZFINID:ZDB-GENE-121214-331 Length:234 Species:Danio rerio


Alignment Length:227 Identity:69/227 - (30%)
Similarity:106/227 - (46%) Gaps:35/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KNLRMVNNGHSIQLSGFDHELTLSGGALLQDFVVEQIHMHW---------WSEHTINDIRYPLEV 131
            |.||  ||||:::.......:.:.||.|...:.|.|.|.||         .|||::|..|:|:|:
Zfish     2 KMLR--NNGHTVECKLKAGVVGVQGGGLKHKYTVLQFHFHWGGRDPRQQPGSEHSLNRHRWPVEM 64

  Fly   132 HIVHRNTIYPNMTMAANFKDGIVVIGVLYH-VSNTPNEAIGSIIKSLGAV-KSYDSMNKPVLVAD 194
            |||.|.|.. |.:.|:...||..|:|.... ..|..::...:.::.|..: :..|:    |.:.|
Zfish    65 HIVSRRTDL-NDSAASRVPDGFAVMGFFIDGKENVTSQVWENFMEYLQKIPRKGDT----VRITD 124

  Fly   195 SLAVDDLVPSVE--NYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEGKQLHNN 257
            .:::..|:..|:  .|:.|:||||||.|.|||.|.|..:...::.||:..|:.:.:.      ..
Zfish   125 DISLQQLLTGVDLSRYYRYSGSLTTPPCDEAVQWTVFKDPIIISTDQLLRFQTVSFG------YV 183

  Fly   258 YRELQSENNRAVVLVEQPEQRSGSAGLTASVS 289
            ||..||.|.|.|.         .||.|.|..|
Zfish   184 YRPQQSLNKRTVY---------ASAALAADAS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 63/205 (31%)
si:ch211-173d10.4XP_021336146.1 alpha_CA 1..196 CDD:320708 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.