DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and Car10

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:300 Identity:76/300 - (25%)
Similarity:139/300 - (46%) Gaps:41/300 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLIALSLIVCCS-------VSFSWANEWGYPDLDNNQDEPFPK-WG------GLCDSGKKQSPI 51
            :.|:..:.|||.|       :...|   |.|.::......|.|. ||      .||..||:|||:
  Rat     8 LFLLQANFIVCISAQQNSPKIHEGW---WAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPV 69

  Fly    52 NLHVKGALKGEFDALKFENYDEHQKNLRMVNNGHSIQLS-GFDHELTLSGGALLQDFVVEQIHMH 115
            |:.....:...|......|....:.:..|.|.|..:.|. ..:|.:.:|||.:.....:|:|.:|
  Rat    70 NIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLH 134

  Fly   116 W------WSEHTINDIRYPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSI 173
            :      .|||.:|...:..||.::|.| .:|.|:|.||...:|:||:.:...||::.|..:..:
  Rat   135 FGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRM 199

  Fly   174 IKSLGAVKSYDSMNKPVLVADS-----LAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETF 233
            :       :.|::.:.....|:     |.:::|.|...::.||.||:|.|.|.|..:||::.:..
  Rat   200 L-------NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPV 257

  Fly   234 PVTLDQVNEFKEIEYDEGKQ----LHNNYRELQSENNRAV 269
            .:|..|::..:.:..::..|    :.:|:|.:|..|||.:
  Rat   258 YITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 62/240 (26%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.