DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH7 and ca14

DIOPT Version :9

Sequence 1:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:288 Identity:89/288 - (30%)
Similarity:138/288 - (47%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIALSLIVCCSVSFSW--ANEWGYPDLDNNQDEP--FPKWGGLCDSGKKQSPINLHVKGALKGE- 62
            ::.|||:: .|:|...  .:||.|......::.|  :|..||..     |||||:........| 
 Frog     1 MLCLSLLI-LSISHVTVRGSEWTYAGHHGQENWPVTYPDCGGTA-----QSPINIQTSNISYDES 59

  Fly    63 FDALKFENYD-EHQKNLRMVNNGHSIQLSGFDHELTLSGGALLQDFVVEQIHMHW-------WSE 119
            ...::.|.|: ...:...:.|||||::|| ....:||.|  |...|...|:|:||       .||
 Frog    60 LPPIEPEGYNTPGNQPFTLTNNGHSVELS-LPSSMTLRG--LPNTFKAAQLHLHWGSPAKQAGSE 121

  Fly   120 HTINDIRYPLEVHIVHRNT-IYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGAVKSY 183
            |.::...:|.|:||||.|: .|.:::.|.|..||:.|:||.:.:..|.|.|..:|:..|..::..
 Frog   122 HRLDGEEFPAELHIVHYNSDKYADISEAKNKPDGLAVLGVFFEIGATDNPAYANILHHLDNIRYK 186

  Fly   184 DSMNKPVLVADSLAVDDLVP-SVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIE 247
            |.    .:...|..|..|:| ::|.||.|.||||||.|.::|.|.|......::..|:.:.:...
 Frog   187 DQ----TVSVPSFNVRHLLPENLEEYFRYQGSLTTPPCYQSVLWTVFYHPVEISRSQLEKLQTTL 247

  Fly   248 YD------EGKQLHNNYRELQSENNRAV 269
            |.      ..:.|.||.||.|..|:|.|
 Frog   248 YSTTATEVPPEVLGNNVREAQLLNSRTV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 76/240 (32%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.