Sequence 1: | NP_001262446.1 | Gene: | nerfin-2 / 41235 | FlyBaseID: | FBgn0041105 | Length: | 775 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_115983.3 | Gene: | INSM2 / 84684 | HGNCID: | 17539 | Length: | 566 | Species: | Homo sapiens |
Alignment Length: | 436 | Identity: | 113/436 - (25%) |
---|---|---|---|
Similarity: | 145/436 - (33%) | Gaps: | 190/436 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 297 EELHNQAVNGLARLFDRDFPEPDVEVSGL----AELQSNSGKTYTDLS----GVATAEIRTTSSD 353
Fly 354 NLPPPPPPPPPPA------------------------------------TSTIPATPPLP----- 377
Fly 378 -------PPPISRPHKAE--------------RRRSK-------------------LRKHMAIDE 402
Fly 403 ETISPVSGTIIRKLRDDEELVVRKGDIDPAFNVVEITEEAKAILASIDNKIGDYMCQLCRTVYDD 467
Fly 468 AFMLAQHRCPRIVHIEYKCSECEKVFNCPANLASHRRWHKPK---AEAAGVNPA----------- 518
Fly 519 ----------------KKRVVETGDLVQEA----------------------------------- 532
Fly 533 -----------TRSGDDASDGIYPCHICGKTFRRQAYLKKHQASHQ 567 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nerfin-2 | NP_001262446.1 | C2H2 Zn finger | 458..481 | CDD:275368 | 15/22 (68%) |
C2H2 Zn finger | 486..506 | CDD:275368 | 16/19 (84%) | ||
zf-C2H2 | 544..566 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 546..566 | CDD:275368 | 12/19 (63%) | ||
INSM2 | NP_115983.3 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 32..117 | 23/80 (29%) | |||
PdxA | 140..>203 | CDD:294567 | 11/62 (18%) | ||
C2H2 Zn finger | 265..285 | CDD:275368 | 13/19 (68%) | ||
zf-C2H2 | 291..313 | CDD:278523 | 17/21 (81%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 16/19 (84%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..418 | 15/107 (14%) | |||
zf-C2H2 | 426..448 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 428..448 | CDD:275368 | 12/19 (63%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | |||
C2H2 Zn finger | 527..548 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3993 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002683 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8472 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15065 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3291 |
SonicParanoid | 1 | 1.000 | - | - | X1791 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.900 |