DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nerfin-2 and ZNF140

DIOPT Version :9

Sequence 1:NP_001262446.1 Gene:nerfin-2 / 41235 FlyBaseID:FBgn0041105 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_011533135.1 Gene:ZNF140 / 7699 HGNCID:12925 Length:458 Species:Homo sapiens


Alignment Length:146 Identity:36/146 - (24%)
Similarity:58/146 - (39%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 EEAKAILASIDNKIGDYM---------CQLCRTVYDDAFMLAQHRCPRIVHIEYKCSECEKVFNC 495
            :|.....:.|.|.:...|         |:.|...:.....|.:|:........|:|:||.|.|:.
Human   193 KECGKTFSQISNLVKHQMIHTGKKPHECKDCNKTFSYLSFLIEHQRTHTGEKPYECTECGKAFSR 257

  Fly   496 PANLASHRRWH----------KPKAEAAGVNPAKKRVVETGDLVQEATRSGDDASDGIYPCHICG 550
            .:||..|:|.|          ..||.::|....:.::..||:..              |.|..||
Human   258 ASNLTRHQRIHIGKKQYICRKCGKAFSSGSELIRHQITHTGEKP--------------YECIECG 308

  Fly   551 KTFRRQAYLKKHQASH 566
            |.|||.::|.:||:.|
Human   309 KAFRRFSHLTRHQSIH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nerfin-2NP_001262446.1 C2H2 Zn finger 458..481 CDD:275368 4/22 (18%)
C2H2 Zn finger 486..506 CDD:275368 9/19 (47%)
zf-C2H2 544..566 CDD:278523 11/21 (52%)
C2H2 Zn finger 546..566 CDD:275368 10/19 (53%)
ZNF140XP_011533135.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 160..>453 CDD:227381 36/146 (25%)
C2H2 Zn finger 164..184 CDD:275368
zf-H2C2_2 176..201 CDD:290200 1/7 (14%)
C2H2 Zn finger 192..212 CDD:275368 4/18 (22%)
zf-H2C2_2 204..229 CDD:290200 4/24 (17%)
C2H2 Zn finger 220..240 CDD:275368 4/19 (21%)
zf-H2C2_2 233..257 CDD:290200 8/23 (35%)
C2H2 Zn finger 248..268 CDD:275368 9/19 (47%)
zf-H2C2_2 260..285 CDD:290200 7/24 (29%)
C2H2 Zn finger 276..296 CDD:275368 3/19 (16%)
zf-H2C2_2 288..313 CDD:290200 8/38 (21%)
C2H2 Zn finger 304..324 CDD:275368 10/19 (53%)
C2H2 Zn finger 332..352 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
zf-H2C2_2 372..397 CDD:290200
C2H2 Zn finger 388..408 CDD:275368
zf-H2C2_2 400..424 CDD:290200
C2H2 Zn finger 416..436 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8156
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.