DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nerfin-2 and Insm1

DIOPT Version :9

Sequence 1:NP_001262446.1 Gene:nerfin-2 / 41235 FlyBaseID:FBgn0041105 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_058585.2 Gene:Insm1 / 53626 MGIID:1859980 Length:521 Species:Mus musculus


Alignment Length:414 Identity:116/414 - (28%)
Similarity:152/414 - (36%) Gaps:169/414 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 PPPPPPPPPPATSTIPATPPLPPPPISRPHKAERRRSKLRKHMAIDEETISPVSGTIIRKLRDDE 420
            ||...|.||.|.:|.|.......|...:| ||      :||....||.|.|||.|          
Mouse   200 PPGKRPAPPAAVATEPPAKAAKAPSAKKP-KA------IRKLHFEDEVTTSPVLG---------- 247

  Fly   421 ELVVRKGDIDPAFNVVEITEEAKAILASIDNKIGDYMCQLCRTVYDDAFMLAQHRCPRIVHIEYK 485
             |.:::|.:          |..:.........:|:::||||:..|.|.|.||||:|.|||.:||:
Mouse   248 -LKIKEGPV----------EAPRGRAGGATRPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYR 301

  Fly   486 CSECEKVFNCPANLASHRRWHKPK-------------------AEAAGVNPAKKRVVETGDLVQE 531
            |.||.|||:||||||||||||||:                   .||||...:.:.....|.:   
Mouse   302 CPECAKVFSCPANLASHRRWHKPRPVPAAARAPEPEAATRAEAREAAGGGSSDRDTPSPGGV--- 363

  Fly   532 ATRSGDDASDGIYPCHICGKTFRRQAYLKKHQASHQMLDNLKNLDFFKSQQQQLTINGHQLADHV 596
             :.||.:  ||:|.||.|.|.|||||||:||..:|                            |.
Mouse   364 -SESGSE--DGLYECHHCAKKFRRQAYLRKHLLAH----------------------------HQ 397

  Fly   597 QLQHTTGQAVTSAAPYASLPRPPPGMPMYPPPSGKN----YPG---------------------- 635
            .||       ...||    |.|||     |||..::    |.|                      
Mouse   398 ALQ-------AKGAP----PPPPP-----PPPPAEDILAFYAGPDEKAPQEASGDGEAAGVLGLS 446

  Fly   636 -----------GQRFPG----------------FPFQSFDQRRFYSLGEFYLSQHLERSSAFQYV 673
                       |:.||.                ||.:       |....||.|..|.|       
Mouse   447 ATAQCHLCPVCGETFPSKGAQERHLRLLHAAQVFPCK-------YCPATFYSSPGLTR------- 497

  Fly   674 QANHLRQL--SNVAQTLMPPLPVK 695
               |:.:.  |...|.::..:||:
Mouse   498 ---HINKCHPSENRQVILLQVPVR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nerfin-2NP_001262446.1 C2H2 Zn finger 458..481 CDD:275368 14/22 (64%)
C2H2 Zn finger 486..506 CDD:275368 16/19 (84%)
zf-C2H2 544..566 CDD:278523 14/21 (67%)
C2H2 Zn finger 546..566 CDD:275368 13/19 (68%)
Insm1NP_058585.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
SNAG domain. /evidence=ECO:0000305|PubMed:24227653 1..20
Required and sufficient for interaction with KDM1A. /evidence=ECO:0000250|UniProtKB:Q01101 2..7
Necessary for interaction with CCND1. /evidence=ECO:0000250 43..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..230 10/30 (33%)
C2H2 Zn finger 274..294 CDD:275368 12/19 (63%)
C2H2 Zn finger 302..322 CDD:275368 16/19 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..369 12/52 (23%)
zf-C2H2 373..395 CDD:278523 14/21 (67%)
C2H2 Zn finger 375..395 CDD:275368 13/19 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..419 11/36 (31%)
C2H2 Zn finger 454..475 CDD:275368 3/20 (15%)
C2H2 Zn finger 482..503 CDD:275368 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3993
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002683
OrthoInspector 1 1.000 - - mtm8711
orthoMCL 1 0.900 - - OOG6_109400
Panther 1 1.100 - - O PTHR15065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3291
SonicParanoid 1 1.000 - - X1791
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.