DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nerfin-2 and nerfin-1

DIOPT Version :9

Sequence 1:NP_001262446.1 Gene:nerfin-2 / 41235 FlyBaseID:FBgn0041105 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_524783.1 Gene:nerfin-1 / 44786 FlyBaseID:FBgn0028999 Length:469 Species:Drosophila melanogaster


Alignment Length:426 Identity:135/426 - (31%)
Similarity:201/426 - (47%) Gaps:95/426 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 PEPDVEVSGLAELQSNSGKTYTDLSGVATAEIR--TTSSDNLP-PPPPPPPPPA----------- 366
            |..||.::      :...:.|::.:..:::|::  .|..:.|| .||.||..||           
  Fly    78 PSSDVPMA------ATFAEVYSENTSASSSEVQGEVTKVEELPVKPPTPPQSPAGKRKLSRESYD 136

  Fly   367 --------------TSTIPATPPLPPPPISRPHKAER--------RRSKLRKHMAIDEETISPVS 409
                          ..|:.:||..|........|..:        .|:|..:.:..||||.||||
  Fly   137 DEPAKMAKKEEEVPVETVESTPAKPVKVAESAPKTNKASTSSGKPSRNKATRKLKFDEETSSPVS 201

  Fly   410 GTIIRKLRD--DEELVVRKGDIDPAFNVVEITEEAKAILASIDNKIGDYMCQLCRTVYDDAFMLA 472
            ||:||.|.|  |..:....|||||.:|:||||||.||.||:|.|.||||:|:||:..::|||.||
  Fly   202 GTVIRPLEDITDGSMQYSNGDIDPKYNIVEITEETKAELAAIKNVIGDYVCRLCKIKFEDAFGLA 266

  Fly   473 QHRCPRIVHIEYKCSECEKVFNCPANLASHRRWHKPKAEAAGV-------NPAKKRVVETGDLVQ 530
            :|||..||.:||:|.||.|.||||||||||||||||:.||:..       .|.|::.||      
  Fly   267 RHRCACIVLLEYRCPECGKQFNCPANLASHRRWHKPRKEASKKENRNTTNQPEKQQQVE------ 325

  Fly   531 EATRSGDDASDGIYPCHICGKTFRRQAYLKKHQASHQMLDNLKNLDFFKSQQQQLTINGHQLADH 595
              .:|.::.:   :.|..|||.|:|.|||:|||.:||..:        |..::||          
  Fly   326 --KKSEEELA---FDCQECGKKFKRAAYLRKHQLTHQKKE--------KPAEKQL---------- 367

  Fly   596 VQLQHTT---------GQAVTSAAPYASLPRPPPGMPMYPPPSGKNYPGGQRFPGFPFQSFDQRR 651
             :::.||         .|||::::. ||......|:.:....:.:||.....:......|.....
  Fly   368 -EMKPTTTTITGSFHFNQAVSTSSS-ASSSHSDEGVYVVGSNARENYDYDNDYLSDSSSSASSAG 430

  Fly   652 FYSLGEFYLSQH-LERSSAFQYVQANHLRQLSNVAQ 686
            :   |...:.:| |....:.......:||..::|.|
  Fly   431 Y---GRLQIVEHGLTEEESIAAAALTNLRNCASVIQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nerfin-2NP_001262446.1 C2H2 Zn finger 458..481 CDD:275368 12/22 (55%)
C2H2 Zn finger 486..506 CDD:275368 16/19 (84%)
zf-C2H2 544..566 CDD:278523 12/21 (57%)
C2H2 Zn finger 546..566 CDD:275368 12/19 (63%)
nerfin-1NP_524783.1 C2H2 Zn finger 252..272 CDD:275368 11/19 (58%)
C2H2 Zn finger 280..300 CDD:275368 16/19 (84%)
zf-C2H2 334..356 CDD:278523 12/21 (57%)
C2H2 Zn finger 336..356 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11215
eggNOG 1 0.900 - - E1_KOG3993
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D535982at33208
OrthoFinder 1 1.000 - - FOG0002683
OrthoInspector 1 1.000 - - mtm6617
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15065
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3291
SonicParanoid 1 1.000 - - X1791
98.950

Return to query results.
Submit another query.