DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and Npc2

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:62/143 - (43%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNTMKKLS 75
            |:|:::..|.|:....:.|. |.......|.:..|...||.|.||....::|.|  |..|..:.|
Mouse     9 LLLALVAASQAEPLHFKDCG-SKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITF--TSGTQSQNS 70

  Fly    76 -AEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRL 139
             |.||....|:.:|:.:....|  |.:   |..||:...:..:|...|||....|.:...:|.:|
Mouse    71 TALVHGILEGIRVPFPIPEPDG--CKS---GINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKL 130

  Fly   140 LDSDDENRVVSCF 152
              .||:...:.|:
Mouse   131 --EDDKKNNLFCW 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 34/128 (27%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.