DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and npc2.2

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001122191.1 Gene:npc2.2 / 565099 ZFINID:ZDB-GENE-080723-11 Length:149 Species:Danio rerio


Alignment Length:143 Identity:38/143 - (26%)
Similarity:62/143 - (43%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVAT--RNTMKK 73
            ::||.:..:.||......|. |.:.:.:.|.|..|...||.|.||....:::.|:::  ..|.| 
Zfish     9 ILLSFLAYTCADPVKFVDCG-SVHGKVVQVDIKPCSQQPCQLHKGQSYTVNVTFISSVASQTSK- 71

  Fly    74 LSAEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVR 138
              |.||.....|.:|:.:....|  |.:   |..||:...:...|...|||.|..|.:...:|..
Zfish    72 --AVVHGVVECVPVPFPIPIDDG--CKS---GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWE 129

  Fly   139 LLDSDDENRVVSC 151
            |  .||.::.:.|
Zfish   130 L--RDDSSKDLFC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 34/128 (27%)
npc2.2NP_001122191.1 Npc2_like 24..145 CDD:238458 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.