DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and Npc2g

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster


Alignment Length:171 Identity:39/171 - (22%)
Similarity:67/171 - (39%) Gaps:32/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSFKKLSLCLVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDC-----------DAL---PCDL 52
            ||.:.:::.:|| |..::.|:......|.||         :|.|           :||   .|::
  Fly     5 SSLQAVAIAIVL-ISSSASAEVVNFEPCPDS---------VDTCTIQQVRVSPCPEALNNAACNI 59

  Fly    53 WKGTEAKIDIQFVATRNTMKKLSAEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVT 117
            .:...:::...|  |.|    ..|:..:.|||.....::|.....:.|.......||:.:|...|
  Fly    60 RRKHNSEMSFDF--TPN----FDADTLVASLGWAKSENVELPLLTLDSAACKYTPCPVRSGVKQT 118

  Fly   118 YQLLLPVTTNQPEVPTRLEVRLLDSDDENRVVSCFLADTRV 158
            |..|:|:....|..|..:...|.|...:.|  .||..|.:|
  Fly   119 YTTLVPIEAKFPLSPYTIRWALKDPVSQKR--CCFTIDIKV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 31/142 (22%)
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.