DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and Npc2f

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster


Alignment Length:135 Identity:29/135 - (21%)
Similarity:48/135 - (35%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNTMKKLSAEV-----HLTS 82
            |.|...|. |.| |...:.|:.|..|||.:.:....|:.::|....|.:..|..||     ::.:
  Fly    43 SLPFEDCG-SLY-QVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVFNYIKT 105

  Fly    83 LGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRLLDSDDENR 147
            .....|...:...|           |...|.....|...:.|....|.:...:.....|::|:|.
  Fly   106 QAAITPDPCDGDHG-----------CIESASGGKAYWANIFVNETLPVMKGSMLWESKDANDQNL 159

  Fly   148 VVSCF 152
            :  ||
  Fly   160 I--CF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 27/132 (20%)
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.