DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and Npc2

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_775141.2 Gene:Npc2 / 286898 RGDID:628756 Length:152 Species:Rattus norvegicus


Alignment Length:150 Identity:37/150 - (24%)
Similarity:63/150 - (42%) Gaps:11/150 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNTMKKLS 75
            |:|:::..:.|:....:.|. |.......|.:..|...||.|.||....:::.|  |..|..:.|
  Rat    12 LLLALVAATQAEPLHFKDCG-SKVGVIKEVNVSPCPTQPCQLHKGQSYSVNVTF--TSGTQSQNS 73

  Fly    76 -AEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRL 139
             |.||....||.:.:.:....|..|     |..||:...:..:|...|||.:..|.:...:|.:|
  Rat    74 TALVHGILAGVPVYFPIPEPDGCKC-----GINCPIQKDKVYSYLNKLPVKSEYPSLKLVVEWKL 133

  Fly   140 LDSDDENRVVSCFLADTRVK 159
            .|...:|  :.|:.....:|
  Rat   134 QDDKKDN--LFCWEIPVEIK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 33/129 (26%)
Npc2NP_775141.2 Npc2_like 27..148 CDD:238458 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.