DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and npc2.1

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2.1 / 282673 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio


Alignment Length:143 Identity:38/143 - (26%)
Similarity:60/143 - (41%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVA--TRNTMKK 73
            ::||.:..:.||......|...: .:.:.|.|..|...||.|.||....:::.|.:  ...|.| 
Zfish     9 VLLSFLAYTCADPVKFVDCGSVD-GKVVQVDIKPCSQQPCKLHKGQSYTVNVTFSSGVESQTSK- 71

  Fly    74 LSAEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVR 138
              |.||....||.:|:.:....|  |.:   |..||:...:...|...|||.|..|.:...:|..
Zfish    72 --AVVHGVLAGVPVPFPIPIDDG--CKS---GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWE 129

  Fly   139 LLDSDDENRVVSC 151
            |  .||.::.:.|
Zfish   130 L--RDDSSKDLFC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 34/128 (27%)
npc2.1NP_775331.1 Npc2_like 24..145 CDD:238458 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.