DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2c and NPC2

DIOPT Version :9

Sequence 1:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens


Alignment Length:147 Identity:42/147 - (28%)
Similarity:68/147 - (46%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLSIMWTSVADSTPIRQC--ADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNTMKK 73
            |:|::...:.|:....:.|  .|....:   |.:..|...||.|.||....:::.|  |.|...|
Human     9 LLLALSTAAQAEPVQFKDCGSVDGVIKE---VNVSPCPTQPCQLSKGQSYSVNVTF--TSNIQSK 68

  Fly    74 LS-AEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLL--LPVTTNQPEVPTRL 135
            .| |.||...:||.:|:.:....|  |.:   |..||:.  :|.||..|  |||.:..|.:...:
Human    69 SSKAVVHGILMGVPVPFPIPEPDG--CKS---GINCPIQ--KDKTYSYLNKLPVKSEYPSIKLVV 126

  Fly   136 EVRLLDSDDENRVVSCF 152
            |.:|  .||:|:.:.|:
Human   127 EWQL--QDDKNQSLFCW 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 39/132 (30%)
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.