DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and AT3G11780

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001189862.1 Gene:AT3G11780 / 820352 AraportID:AT3G11780 Length:171 Species:Arabidopsis thaliana


Alignment Length:166 Identity:40/166 - (24%)
Similarity:68/166 - (40%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFEIDFAVDKYIT 73
            ||..||:|...|     ||.|..|..::.:  ||:|......|..|.:|....|.|....|..|:
plant    12 ISYFLLVSTIVA-----ATDVHYCDNNEEY--EVKVQGVDITPYPIARGEPATFRISANTDTEIS 69

  Fly    74 QLTTLVKATTLG--IITVPYELPADVAAVCP------NLQYGAYCPLY--PTE------DVSYLF 122
            ....:::.:..|  |.:..::|..:.:  ||      .:.:....|.|  |||      .::| :
plant    70 SGKLVIEVSYFGWHIHSETHDLCDETS--CPVAIGDFLVAHSQVLPGYTPPTEKRFNLVSIAY-Y 131

  Fly   123 TFPI-GEYPEIGVKIEIYLVDQDNEIATC--FVCDI 155
            .|.: |.|     .:::.::|...:..||  |..||
plant   132 EFHVEGSY-----SLKMKMLDGRKKELTCIKFSFDI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 30/144 (21%)
AT3G11780NP_001189862.1 PG-PI_TP 27..160 CDD:238459 30/142 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.