DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and Npc2

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:146 Identity:44/146 - (30%)
Similarity:59/146 - (40%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFEIDFAVDKYITQLTT 77
            |||:|..|.|..| ...|.|........||.|..|.|.|||:.||.:....|.|.........|.
Mouse     9 LLLALVAASQAEP-LHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTA 72

  Fly    78 LVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-GEYPEIGVKIEIYLV 141
            ||.....| |.||:.:|..     ...:.|..||:...:..|||...|: .|||.|.:.:|..|.
Mouse    73 LVHGILEG-IRVPFPIPEP-----DGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLE 131

  Fly   142 DQDNEIATCFVCDIKV 157
            |.......|:...:::
Mouse   132 DDKKNNLFCWEIPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 37/126 (29%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.